| IED ID | IndEnz0002013147 |
| Enzyme Type ID | protease013147 |
| Protein Name |
Kunitz-type U15-theraphotoxin-Hs1e U15-TRTX-Hs1e Huwentoxin HW11c24 Kunitz-type serine protease inhibitor HWTX-XI-IS24 |
| Gene Name | |
| Organism | Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Araneae (spiders) Mygalomorphae (mygalomorph spiders) Theraphosidae (tarantulas) Haplopelma Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) |
| Enzyme Sequence | MGTARFLSAVLLLSVLLMVTFPALLSAEYHDGRVDICSLPSDSGDRLRFFEMWYFDGTTCTKFVYGGYGGNDNRFPTEKACMKRCAKA |
| Enzyme Length | 88 |
| Uniprot Accession Number | P0DJ81 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Toxin with inhibitory activity on serine proteases, but not on potassium channels (PubMed:24418069). The recombinant toxin is active against trypsin (Ki=9.61 nM), kallikrein (Ki=24.8 nM), and chymotrypsin (PubMed:24418069). {ECO:0000269|PubMed:24418069}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Propeptide (1); Signal peptide (1); Site (2) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:18923708}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,832 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |