| IED ID | IndEnz0002013154 |
| Enzyme Type ID | protease013154 |
| Protein Name |
PI-stichotoxin-Hcr2i PI-SHTX-Hcr2i Kunitz-peptide HCIQ2c1 |
| Gene Name | iq2c1 |
| Organism | Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Enzyme Sequence | MKGTFLICLILIAGFYFRSIQGFYFKRIQGNICSEPKKVGRCRGSFPRFYFDSETGKCTPFIYGGCGGNGNNFETLHACRAICRA |
| Enzyme Length | 85 |
| Uniprot Accession Number | A0A6B7FBD3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that also shows protective effect in a cytotoxicity model. It binds to all proteases tested (trypsin (Ki=52 nM), alpha-chymotrypsin, cathepsin G, kallikrein, and human neutrophil elastase). It significantly increases neuroblastoma cell viability in an in vitro neurotoxicity model (in which cytotoxicity is induced by 6-hydroxydopamine (6-OHDA)) being a consequence of an effective decrease of reactive oxygen species (ROS) level in the cells. {ECO:0000269|PubMed:32144281}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Propeptide (1); Signal peptide (1); Site (2) |
| Keywords | Cleavage on pair of basic residues;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P31713}. Nematocyst {ECO:0000250|UniProtKB:P31713}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,552 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |