| IED ID | IndEnz0002013180 |
| Enzyme Type ID | protease013180 |
| Protein Name |
Kunitz-type kappaPI-theraphotoxin-Hs1a KappaPI-TRTX-Hs1a Huwentoxin-11g8 HW11g8 Huwentoxin-XI HwTx-XI Kunitz-type serine protease inhibitor huwentoxin-11 |
| Gene Name | |
| Organism | Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Araneae (spiders) Mygalomorphae (mygalomorph spiders) Theraphosidae (tarantulas) Haplopelma Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) |
| Enzyme Sequence | MGIARILSAVLFLSVLFVVTFPALLSADHHDGRIDTCRLPSDRGRCKASFERWYFNGRTCAKFIYGGCGGNGNKFPTQEACMKRCAKA |
| Enzyme Length | 88 |
| Uniprot Accession Number | P68425 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that inhibits both serine proteases (trypsin) and voltage-gated potassium channels (Kv). The toxin is more active on Kv1.1/KCNA1 (78% inhibition), than on Kv1.2/KCNA2 (10% inhibition), and Kv1.3/KCNA3 (28% inhibition), although a high dose (5 uM) is needed. The inhibition of potassium channels is voltage-dependent. {ECO:0000269|PubMed:15066414, ECO:0000269|PubMed:16820861}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (1); Disulfide bond (3); Domain (1); Helix (1); Mutagenesis (3); Propeptide (1); Sequence conflict (2); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15066414}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 2JOT; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,721 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |