| IED ID | IndEnz0002013181 |
| Enzyme Type ID | protease013181 |
| Protein Name |
PI-actitoxin-Axm2a PI-AITX-Axm2a Kunitz-type protease inhibitor AXPI-I AXAPI |
| Gene Name | |
| Organism | Anthopleura aff. xanthogrammica (Sea anemone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Actiniidae Anthopleura Anthopleura aff. xanthogrammica (Sea anemone) |
| Enzyme Sequence | APVNEDCLLPKKVGPCRAAVPRFYYNSDSGKCEGFTYGGCHANANNFKTKDECKNACH |
| Enzyme Length | 58 |
| Uniprot Accession Number | P81547 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that is strongly active against trypsin (1900 IU/mg) and moderately active against plasmin. Also shows weak inhibition against chymotrypsin (70%), elastase (38%) and the metalloprotease thermolysin (14%). {ECO:0000269|PubMed:18450492, ECO:0000269|PubMed:9440231}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,341 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |