| IED ID | IndEnz0002013182 |
| Enzyme Type ID | protease013182 |
| Protein Name |
Telobox protein 1 Meiotically up-regulated gene 152 protein |
| Gene Name | teb1 mug152 spX SPAC13G7.10 |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (Fission yeast) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Enzyme Sequence | MRSMKPPGFSSDLMDEHSVDLLNGSILAAENPSKREVAQDVPGFERKPTKVRKPRVKWTEKETNDLLRGCQIHGVGNWKKILLDERFHFTNRSPNDLKDRFRTILPEDYKKFYPNAKTHMGRPQKIPHTVGLSKSTRKERKQFTPEEDERLLEGFFLHGPCWTRISKDANLGLQNRRSTDLRDRFRNAFPERYAAAGFKLKNNPGNRSKYYQNNMVNDATTPNDSSTTEAAAAAVAAVAAVAASNPNASPQQTTEQPASDELLDWPHHNLPSQFFTSQRNPNYSTDSFLLGQSLSDPFNHTLQSFHPYESLFSAGQPPSLPISPSTSQNSVQPFPFSIQQPPLHLEPPLSSNTLNSSTLPQPNSTDFNTFPPLPSTPRISSEDIPWDNRG |
| Enzyme Length | 390 |
| Uniprot Accession Number | Q10274 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 78..105; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625; DNA_BIND 162..189; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625 |
| EC Number | |
| Enzyme Function | FUNCTION: General transcription factor with prominent roles in controlling histone levels and stability. Binds and regulates the activities of many promoters, including those controlling the expression of all four types of canonical histones. Is also involved in the centromeric loading of cnp1 and maintenance of centromere identity. Moreover, regulates the expression of cdc2, a protease capable of histone clipping. {ECO:0000269|PubMed:10572167, ECO:0000269|PubMed:10606652, ECO:0000269|PubMed:23314747}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (4); DNA binding (2); Domain (2); Region (4); Sequence conflict (1) |
| Keywords | Nucleus;Reference proteome;Repeat;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00625, ECO:0000269|PubMed:16823372, ECO:0000269|PubMed:23314747}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 20473289; 23697806; 29735745; 30726745; |
| Motif | |
| Gene Encoded By | |
| Mass | 43,922 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |