| IED ID | IndEnz0002013212 |
| Enzyme Type ID | protease013212 |
| Protein Name |
Protein Wnt-8 XWnt-8 |
| Gene Name | wnt8 |
| Organism | Xenopus laevis (African clawed frog) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) |
| Enzyme Sequence | MQNTTLFILATLLIFCPFFTASAWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR |
| Enzyme Length | 358 |
| Uniprot Accession Number | P28026 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in ventral mesodermal patterning during embryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone. {ECO:0000269|PubMed:7906224}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (11); Chain (1); Disulfide bond (11); Glycosylation (3); Helix (11); Lipidation (1); Sequence caution (1); Sequence conflict (2); Signal peptide (1); Site (2); Turn (4) |
| Keywords | 3D-structure;Developmental protein;Disulfide bond;Extracellular matrix;Glycoprotein;Lipoprotein;Secreted;Signal;Wnt signaling pathway |
| Interact With | Q6PA07; Q61091 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix. |
| Modified Residue | |
| Post Translational Modification | PTM: Palmitoleoylation is required for efficient binding to frizzled receptors (PubMed:22653731). Depalmitoleoylation leads to Wnt signaling pathway inhibition (By similarity). {ECO:0000250|UniProtKB:P56704, ECO:0000269|PubMed:22653731}.; PTM: Proteolytic processing by tiki1 and tiki2 promotes oxidation and formation of large disulfide-bond oligomers, leading to inactivation of wnt8. {ECO:0000269|PubMed:22726442}. |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4F0A; |
| Mapped Pubmed ID | 21772251; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,176 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |