| IED ID | IndEnz0002013233 |
| Enzyme Type ID | protease013233 |
| Protein Name |
Putative ubiquitin carboxyl-terminal hydrolase 50 EC 3.4.19.12 Deubiquitinating enzyme 50 Ubiquitin thioesterase 50 Ubiquitin-specific-processing protease 50 |
| Gene Name | Usp50 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MCFIDMASHRPVPADDFGAYYNLAECADYDSLPESKTQPHFQGVTGLRNLGNTCYMNAILQCLCSVSPLVEYFLSGKYITALKKDCSEVTTAFAYLMTDMWLGDSDCVSPEIFLSAVGSLYPAFLKKTQQDAQEFLIYVLNELHEALKKHCRRRVNEKRTGQSCCRKVPAQETSIITRLFEGQLSYSITCLKCESCTHKNEVFTILSLPIPSDYECSLQDCLQCFFQQDTLTWSNQIYCSFCEIKQEAAVRTTISKVPKIIVFHFKRFDIQGTVKRKLRTDIHYPLTNLDLTPYICPVFRKHPMYNLCAVVNHFGDLDGGHYTAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFYSCQPFSIPAQKRKSQDSTPDHCKQAIRKWP |
| Enzyme Length | 390 |
| Uniprot Accession Number | Q6P8X6 |
| Absorption | |
| Active Site | ACT_SITE 54; /note="Nucleophile"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10092, ECO:0000255|PROSITE-ProRule:PRU10093"; ACT_SITE 321; /note="Proton acceptor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10092, ECO:0000255|PROSITE-ProRule:PRU10093" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: May recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Alternative sequence (2); Chain (1); Domain (1); Sequence conflict (1) |
| Keywords | Alternative splicing;Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 14610273; 21267068; 27626380; 28094437; |
| Motif | |
| Gene Encoded By | |
| Mass | 44,543 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |