| IED ID | IndEnz0002013243 |
| Enzyme Type ID | protease013243 |
| Protein Name |
Core protein VP8 25 kDa major core protein L4 core protein P25K |
| Gene Name | L4R |
| Organism | Variola virus |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Variola virus |
| Enzyme Sequence | MSLLLENLIEEDTIFFAGSISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGDDKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKKSGRRKNKNMVIFRQGSSPILCIFETRKKINIYKENMESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELELYSSSPLQEPIRLNDFLGLLECVKKNIPLTDIPTKD |
| Enzyme Length | 251 |
| Uniprot Accession Number | P0DSX0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Major core structural protein. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Site (2) |
| Keywords | Late protein;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000250}. Note=Localizes to the virion core. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Undergoes morphogenesis-associated proteolysis which cleaves the 28 kDa to a 25-kDa product. Proteolytic cleavage of major core proteins P4a (A10L), P4b (A3L), and VP8 (L4R), which occurs at a late stage of core formation, is required for production of infectious mature virions (MV) (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,487 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |