| IED ID |
IndEnz0002013322 |
| Enzyme Type ID |
protease013322 |
| Protein Name |
WAP four-disulfide core domain protein 12
|
| Gene Name |
WFDC12 |
| Organism |
Macaca mulatta (Rhesus macaque) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Deuterostomia
Chordata
Craniata
Vertebrata
Gnathostomata (jawed vertebrates)
Teleostomi
Euteleostomi
Sarcopterygii
Dipnotetrapodomorpha
Tetrapoda
Amniota
Mammalia
Theria
Eutheria
Boreoeutheria
Euarchontoglires
Primates
Haplorrhini
Simiiformes
Catarrhini
Cercopithecoidea
Cercopithecidae (Old World monkeys)
Cercopithecinae
Macaca (macaques)
Macaca mulatta (Rhesus macaque)
|
| Enzyme Sequence |
MGSSSFLVLMVSLALVTLVAAEGVKGGIEKAGVCPADNIRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCPEPGWEAKSPGSSSTGCPQK |
| Enzyme Length |
111 |
| Uniprot Accession Number |
A4K2T3 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Antibacterial protein. Putative acid-stable proteinase inhibitor (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (4); Domain (1); Region (1); Signal peptide (1) |
| Keywords |
Antibiotic;Antimicrobial;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,660 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|