| IED ID |
IndEnz0002013343 |
| Enzyme Type ID |
protease013343 |
| Protein Name |
Modulator of FtsH protease YccA
|
| Gene Name |
yccA b0970 JW0953 |
| Organism |
Escherichia coli (strain K12) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Escherichia
Escherichia coli
Escherichia coli (strain K12)
|
| Enzyme Sequence |
MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMYGLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFETSNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD |
| Enzyme Length |
219 |
| Uniprot Accession Number |
P0AAC6 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Negatively modulates the activity of the FtsH protease for membrane substrates. Overexpression or stabilizing YccA counteracts the FtsH-mediated degradation of SecY when the SecYEG preprotein translocator is jammed. {ECO:0000269|PubMed:19661432}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Mutagenesis (2); Topological domain (8); Transmembrane (7) |
| Keywords |
Cell inner membrane;Cell membrane;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
INDUCTION: Regulated in a Cpx-dependent fashion. {ECO:0000269|PubMed:19661432}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell inner membrane; Multi-pass membrane protein. Note=There are conflicting results regarding the localization of the C-terminus of this protein: According to a report, the C-terminus localizes in the periplasm (PubMed:10357810). Another report gives the C-terminus in the cytoplasm (PubMed:15919996). We show the periplasmic location. {ECO:0000269|PubMed:10357810, ECO:0000269|PubMed:15919996}. |
| Modified Residue |
|
| Post Translational Modification |
PTM: YccA is processively degraded by FtsH; degradation initiates via the approximately 20 residue N-terminal tail in a sequence non-specific manner. The deletion mutant yccA11 is resistant to FtsH-mediated degradation, probably because it is too short to be degraded by FtsH. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
12081643;
15690043;
|
| Motif |
|
| Gene Encoded By |
|
| Mass |
23,363 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|