| IED ID | IndEnz0002013346 |
| Enzyme Type ID | protease013346 |
| Protein Name |
Putative cysteine protease YraA EC 3.2.-.- |
| Gene Name | yraA BSU27020 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MSKKIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGEKVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICHGPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKDAEVVVSHNIVTSRTPDDLEAFNRESLNLLK |
| Enzyme Length | 169 |
| Uniprot Accession Number | O06006 |
| Absorption | |
| Active Site | ACT_SITE 103; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU00608; ACT_SITE 104; /evidence=ECO:0000255|PROSITE-ProRule:PRU00608 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.2.-.- |
| Enzyme Function | FUNCTION: Functions in the protection against aldehyde-stress, possibly by degrading damaged proteins. {ECO:0000269|PubMed:19170879}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Frameshift (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Stress response |
| Interact With | |
| Induction | INDUCTION: The adhR-yraA operon is induced by formaldehyde and methylgloxal, under the control of AdhR (PubMed:19170879). A second yraA-specific transcription unit is not induced by formaldehyde or methylglyoxal and is not controlled by AdhR (PubMed:19170879). Transcribed under partial control of SigM ECF sigma factor (PubMed:17434969). {ECO:0000269|PubMed:19170879}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,512 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |