| IED ID | IndEnz0002013361 |
| Enzyme Type ID | protease013361 |
| Protein Name |
Venom plasminogen activator Haly-PA EC 3.4.21.- |
| Gene Name | |
| Organism | Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Gloydius Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus) |
| Enzyme Sequence | MALIRVLANLLILQLSYAQKSSELVVGGDECNINEHRSLVVLFNSSGLICSGTLINQEWVLTAAHCDSKNFQMLFGVHSKKILNEDEQTRDPKEKFICPNKKKDDEKDKDIMLIRLDSPVSNSEHIAPLSLPSSSPTVDSVCRIMGWGTIKPADETYPDVPHCANINILDHTVCRAAYPVLLAGSSTLCAGTQQGGKDTCVGDSGGPLICNGQIQGIVSWGAHPCGQGSKPGVYTKVFDHLDWIKSIIAGNTAVTCPP |
| Enzyme Length | 258 |
| Uniprot Accession Number | Q9YGJ8 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 110; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 204; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Snake venom serine protease that activates plasminogen. Displays indirect fibrino(geno)lytic activity through conversion of plasminogen to plasmin. Shows a preferential cleavage at Arg-|-Xaa instead of Lys-|-Xaa bonds. {ECO:0000269|PubMed:9839665}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1); Propeptide (1); Signal peptide (1) |
| Keywords | Disulfide bond;Fibrinolytic toxin;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Plasminogen activation;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:9839665}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:9839665}. |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,813 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |