IED ID | IndEnz0002013380 |
Enzyme Type ID | protease013380 |
Protein Name |
Transposon Ty3-I Gag polyprotein Gag3 Transposon Ty3-2 protein A TY3A Cleaved into: Capsid protein CA p24 ; Spacer peptide p3; Nucleocapsid protein p9 NC p7 |
Gene Name | TY3A-I YILWTy3-1 GAG YIL082W |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Enzyme Sequence | MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPNDASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQLSEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAMEEAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRSYNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARKASSNRS |
Enzyme Length | 290 |
Uniprot Accession Number | Q99219 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome.; FUNCTION: Nucleocapsid protein p9 (NC) forms the nucleocore that coats the retro-elements dimeric RNA. Binds these RNAs through its zinc fingers (By similarity). Promotes primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty3 RNA and initiation of reverse transcription. {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (3); Erroneous initiation (1); Initiator methionine (1); Modified residue (1); Peptide (1); Site (2); Zinc finger (1) |
Keywords | Acetylation;Cytoplasm;Metal-binding;Reference proteome;Ribosomal frameshifting;Transposable element;Zinc;Zinc-finger |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
Modified Residue | MOD_RES 2; /note=N-acetylserine; /evidence=ECO:0000250|UniProtKB:Q12173 |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 10466139; 10688190; 11861848; 15956549; 17442718; 18094177; 19536198; 19759143; 21189452; 21917850; 22998189; 23226439; 24603646; 7677953; |
Motif | |
Gene Encoded By | |
Mass | 34,100 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |