| IED ID |
IndEnz0002013385 |
| Enzyme Type ID |
protease013385 |
| Protein Name |
Sigma-w pathway protein YsdB
|
| Gene Name |
ysdB BSU28830 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MFVMVLRIILLALFAYCIYAVVKYVANPKRRLKLAQSKEHFYIIDEQNNTRKNFQLTYKGVLFEGEKHIPSKDHPLFIHTIFVWTESPEKLKHFSAKDFENIEEKVLERYPNCKIDWDQPIKLAKKAEER |
| Enzyme Length |
130 |
| Uniprot Accession Number |
P94520 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: May mediate a negative feedback loop that down-regulates the expression of the sigma-W regulon following the activation of sigma-W in response to conditions of cell envelope stress. Might interact with and inhibit the activity of the protease PrsW, or could bind to the anti-sigma-W factor RsiW and thereby protect it from PrsW-mediated cleavage. {ECO:0000269|PubMed:16816000}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Transmembrane (1) |
| Keywords |
Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
INDUCTION: Expressed under the control of the sigma-W factor. {ECO:0000269|PubMed:12207695}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
15,572 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|