| IED ID | IndEnz0002013395 |
| Enzyme Type ID | protease013395 |
| Protein Name |
TRAF family member-associated NF-kappa-B activator TRAF-interacting protein I-TRAF |
| Gene Name | Tank Itraf |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MSLKRHSLRRNACHLETRAGIPTILYSDATGQRGMDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRDNSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAVTPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVKTEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRATCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET |
| Enzyme Length | 448 |
| Uniprot Accession Number | P70347 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage. Plays a role as an adapter to assemble ZC3H12A, USP10 in a deubiquitination complex which plays a negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage. Promotes UBP10-induced deubiquitination of TRAF6 in response to DNA damage. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. Essential for the efficient induction of IRF-dependent transcription following infection with Sendai virus. {ECO:0000250|UniProtKB:Q92844}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (5); Chain (1); Coiled coil (1); Metal binding (4); Modified residue (6); Region (4); Sequence conflict (1); Zinc finger (1) |
| Keywords | Alternative splicing;Coiled coil;Cytoplasm;DNA damage;Metal-binding;Phosphoprotein;Reference proteome;Zinc;Zinc-finger |
| Interact With | Q9WUN2; P39428; P39429 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 211; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q92844; MOD_RES 246; /note=Phosphothreonine; /evidence=ECO:0000250|UniProtKB:Q92844; MOD_RES 258; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q92844; MOD_RES 261; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q92844; MOD_RES 377; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q92844; MOD_RES 380; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q92844 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10581243; 10725249; 12466851; 14610273; 15102471; 16141072; 16602821; 16919269; 17327220; 18583960; 18799693; 19668221; 21267068; 21625535; 21949249; 22773835; 23139637; 23201825; 23746807; 26238476; 28159912; 30721969; 31792381; 34540911; |
| Motif | |
| Gene Encoded By | |
| Mass | 50,939 |
| Kinetics | |
| Metal Binding | METAL 419; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU01253; METAL 422; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU01253; METAL 439; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU01253; METAL 443; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU01253 |
| Rhea ID | |
| Cross Reference Brenda |