| IED ID | IndEnz0002013422 |
| Enzyme Type ID | protease013422 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase EC 3.4.19.12 Ubiquitin thioesterase |
| Gene Name | UCH |
| Organism | Aplysia californica (California sea hare) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Heterobranchia Euthyneura Tectipleura Aplysiida (sea hares) Aplysioidea Aplysiidae Aplysia Aplysia californica (California sea hare) |
| Enzyme Sequence | MASEQRWIPLESNPKVLNKYVHNLGMDAGWNFVDVFGLDPELLAMVPRPAAALVLLFPDDKETVNQLIGEYQSDYPDSLYYTKQTIGNACGTVAIVHALANNENVIPFDAAKHFKTFLEKTKPLNPEERAKHLEQDNLMGAAHGDCAQEGDTQAPSQDEHVKSHFVALVHCNGTLYELDGRKEAPVVHGTTSADTFLEDAAEVVKKFMARDPEI |
| Enzyme Length | 214 |
| Uniprot Accession Number | O01391 |
| Absorption | |
| Active Site | ACT_SITE 90; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU10091; ACT_SITE 164; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10091 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Site (1) |
| Keywords | Cytoplasm;Hydrolase;Protease;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,703 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |