| IED ID |
IndEnz0002013443 |
| Enzyme Type ID |
protease013443 |
| Protein Name |
UPF0758 protein HEAR2468
|
| Gene Name |
HEAR2468 |
| Organism |
Herminiimonas arsenicoxydans |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Betaproteobacteria
Burkholderiales
Oxalobacteraceae
Herminiimonas
Herminiimonas arsenicoxydans
|
| Enzyme Sequence |
MAITDWPEEQRPRERLIRHGAAILSDAELLAVFLRVGVTGKSAVDLGRDMVAHFGSLNGLFSATLNDFSKINGLGPAKYAQLQAVLELARRSLCEELQAGVALNSPQAVKQYLQLLLSGRAYESFVILFLDVKNRLIVCDEMFRGTLTHTSVYPREIVKAALGHNAASVILAHNHPSGTPEPSAADQTLTQALKQALMLIDVRVLDHFVVAGKQVYSFAEQGQL |
| Enzyme Length |
224 |
| Uniprot Accession Number |
A4G7V9 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
|
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Metal binding (3); Motif (1) |
| Keywords |
Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Zinc |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
MOTIF 173..186; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Gene Encoded By |
|
| Mass |
24,460 |
| Kinetics |
|
| Metal Binding |
METAL 173; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 175; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 186; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Rhea ID |
|
| Cross Reference Brenda |
|