| IED ID | IndEnz0002013460 |
| Enzyme Type ID | protease013460 |
| Protein Name |
Thrombin-like enzyme bhalternin SVTLE EC 3.4.21.- Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Bothrops alternatus (Urutu) (Rhinocerophis alternatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops alternatus (Urutu) (Rhinocerophis alternatus) |
| Enzyme Sequence | MVLIRVLANLLILQLSYAQKASELVIGGDECNINEHRSLVVLFNSSGFLCAGTLINQEWVLTAANCDRKNIRIKLGMHSKNVTNEDEQTRVPKRSTFVSVAKTSHQTLGTRTSMLIRLKRPVNDSPHIAPLSLPSSPPSVGSVCRVMGWGTISPTKVSYPDVPHCANINLLDYEVCREAHGGLPATSRTLCAGILEGGKDSCQGDSGGPLICNGQFQGILSWGVHPCGQPHKPGVYTKVSDYSEWIQSIIAGNTDVTCPP |
| Enzyme Length | 260 |
| Uniprot Accession Number | P0CG03 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by benzamidine and partially inhibited by EDTA. {ECO:0000269|PubMed:20184912}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that induces blood clotting in vitro, defibrinogenation in vivo (by intraperitoneal injection into mice), albuminolytic and fibrinogenolytic activities. Preferentially cleaves the alpha chain of fibrinogen (FGA). Causes hemolysis in the heart, causes apparent hyperemia and lymphocytic interstitial pneumonitis in the lung, causes necrosis and inflammatory infiltrate in the liver, and causes glomerular congestion in the kidney. Also provokes a drastic myonecrosis. {ECO:0000269|PubMed:20184912}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 30-40 degrees Celsius. {ECO:0000269|PubMed:20184912}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0-8.0. {ECO:0000269|PubMed:20184912}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Domain (1); Glycosylation (2); Propeptide (1); Signal peptide (1) |
| Keywords | Blood coagulation cascade activating toxin;Cytolysis;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemolysis;Hemostasis impairing toxin;Hydrolase;Myotoxin;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20184912}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,045 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |