| IED ID | IndEnz0002013461 |
| Enzyme Type ID | protease013461 |
| Protein Name |
Venom plasminogen activator TSV-PA EC 3.4.21.- Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Trimeresurus Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri) |
| Enzyme Sequence | MELIRVLANLLILQLSYAQKSSELVFGGDECNINEHRSLVVLFNSNGFLCGGTLINQDWVVTAAHCDSNNFQLLFGVHSKKILNEDEQTRDPKEKFFCPNRKKDDEVDKDIMLIKLDSSVSNSEHIAPLSLPSSPPSVGSVCRIMGWGKTIPTKEIYPDVPHCANINILDHAVCRTAYSWRQVANTTLCAGILQGGRDTCHFDSGGPLICNGIFQGIVSWGGHPCGQPGEPGVYTKVFDYLDWIKSIIAGNKDATCPP |
| Enzyme Length | 258 |
| Uniprot Accession Number | Q91516 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; /evidence=ECO:0000269|PubMed:9753698; ACT_SITE 110; /note=Charge relay system; /evidence=ECO:0000269|PubMed:9753698; ACT_SITE 204; /note=Charge relay system; /evidence=ECO:0000269|PubMed:9753698 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Snake venom serine protease that activates plasminogen. {ECO:0000269|PubMed:7730329}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (15); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1); Helix (4); Mutagenesis (5); Propeptide (1); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Fibrinolytic toxin;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Plasminogen activation;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:7730329}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000250 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1BQY; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,334 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=26.0 uM for S-2238 {ECO:0000269|PubMed:12081498}; KM=55 nM for plasminogen {ECO:0000269|PubMed:12081498}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |