Detail Information for IndEnz0002013478
IED ID IndEnz0002013478
Enzyme Type ID protease013478
Protein Name Kunitz-type serine protease inhibitor Bi-KTI
Gene Name
Organism Bombus ignitus (Bumblebee)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Aculeata Apoidea (bees) Apidae (bumble bees and honey bees) Apinae (honey bees) Bombini Bombus (bumble bees) Bombus Bombus ignitus (Bumblebee)
Enzyme Sequence MNHKFIALLLVVLCCALAVHQVSAEVPSHCTLSLATGTCKGYFPRFGYNIEMGKCVEFIYGGCDGNANNFRNLEECQQSCSV
Enzyme Length 82
Uniprot Accession Number G3LH89
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Serine protease inhibitor that inhibits plasmin (IC(50)=43.53 nM, Ki=3.6 nM). Acts as an antifibrinolytic agent. May act in a cooperative manner with the serine protease Bi-VSP (AC B5U2W0) to promote the spread of bee venom under anti-bleeding conditions.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1)
Keywords Disulfide bond;Hemostasis impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000250}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..24; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 8,966
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda