| IED ID |
IndEnz0002013478 |
| Enzyme Type ID |
protease013478 |
| Protein Name |
Kunitz-type serine protease inhibitor Bi-KTI
|
| Gene Name |
|
| Organism |
Bombus ignitus (Bumblebee) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Protostomia
Ecdysozoa
Panarthropoda
Arthropoda
Mandibulata
Pancrustacea
Hexapoda
Insecta
Dicondylia
Pterygota (winged insects)
Neoptera
Endopterygota
Hymenoptera
Apocrita (wasps
ants
and bees)
Aculeata
Apoidea (bees)
Apidae (bumble bees and honey bees)
Apinae (honey bees)
Bombini
Bombus (bumble bees)
Bombus
Bombus ignitus (Bumblebee)
|
| Enzyme Sequence |
MNHKFIALLLVVLCCALAVHQVSAEVPSHCTLSLATGTCKGYFPRFGYNIEMGKCVEFIYGGCDGNANNFRNLEECQQSCSV |
| Enzyme Length |
82 |
| Uniprot Accession Number |
G3LH89 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Serine protease inhibitor that inhibits plasmin (IC(50)=43.53 nM, Ki=3.6 nM). Acts as an antifibrinolytic agent. May act in a cooperative manner with the serine protease Bi-VSP (AC B5U2W0) to promote the spread of bee venom under anti-bleeding conditions. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1) |
| Keywords |
Disulfide bond;Hemostasis impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
8,966 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|