| IED ID | IndEnz0002013485 |
| Enzyme Type ID | protease013485 |
| Protein Name |
Whey acidic protein WAP |
| Gene Name | Wap |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MRCLISLVLGLLALEVALAQNLEEQVFNSVQSMFQKASPIEGTECIICQTNEECAQNAMCCPGSCGRTRKTPVNIGVPKAGFCPWNLLQTISSTGPCPMKIECSSDRECSGNMKCCNVDCVMTCTPPVPVITLQ |
| Enzyme Length | 134 |
| Uniprot Accession Number | P01173 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Could be a protease inhibitor. May play an important role in mammary gland development and tissue remodeling. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (6); Domain (2); Sequence conflict (7); Signal peptide (1) |
| Keywords | Disulfide bond;Milk protein;Protease inhibitor;Reference proteome;Repeat;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: No phosphate or carbohydrate binding could be detected; however, both cholesterol and triglyceride are associated with the mouse protein. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11311554; 11494122; 12759187; 12907752; 14661057; 15007206; 16106354; 16141072; 16751266; 17187062; 17541952; 18255060; 18443292; 18500724; 18977342; 19174523; 19208431; 20382704; 20385773; 21267068; 21677750; 22034435; 22588720; 23096997; 24469394; 24749073; 25306215; 26058079; 27058754; 2834201; 30076411; 6896059; 6896688; 7332524; 7522033; 7576607; 7744960; 8000430; 8175886; 8637705; 9021141; 9115715; 9322243; 9841868; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,423 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |