| IED ID | IndEnz0002013530 |
| Enzyme Type ID | protease013530 |
| Protein Name |
Venom peptide SjAPI Ascaris-type protease inhibitor |
| Gene Name | |
| Organism | Scorpiops jendeki (Scorpion) (Scorpiops hardwickii jendeki) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Iurida Chactoidea Euscorpiidae Scorpiopinae Scorpiopini Scorpiops Scorpiops jendeki (Scorpion) (Scorpiops hardwickii jendeki) |
| Enzyme Sequence | MKWGALLCIFGFLAFCSVLDRGLGWIPDIWQKCSSKNEEFQQCGSSCPETCANHKNPEPKSCAAVCFVGCVCKPGFIRDDLKGSICVKPEDCSK |
| Enzyme Length | 94 |
| Uniprot Accession Number | P0DM55 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Recombinant protein inhibits both alpha-chymotrypsin (Ki=97.1 nM) and elastase (Ki=3700 nM). {ECO:0000269|PubMed:23533574}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Domain (1); Mutagenesis (6); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:23533574}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,312 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |