IED ID | IndEnz0002013554 |
Enzyme Type ID | protease013554 |
Protein Name |
Putative D-alanyl-D-alanine carboxypeptidase EC 3.4.16.4 DD-carboxypeptidase DD-CPase |
Gene Name | yfeW SeHA_C2737 |
Organism | Salmonella heidelberg (strain SL476) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Salmonella Salmonella enterica (Salmonella choleraesuis) Salmonella enterica I Salmonella enterica subsp. enterica serovar Heidelberg Salmonella heidelberg (strain SL476) |
Enzyme Sequence | MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQIDAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNFALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKNKLRIIDILHHVAGFPADPQYPNKNVAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAIPLDRYVETTIYKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSMGGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVNGNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFVSGLLPAATYGWIVDQIYGSLK |
Enzyme Length | 432 |
Uniprot Accession Number | B4TD53 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: (Ac)(2)-L-Lys-D-Ala-|-D-Ala. Also transpeptidation of peptidyl-alanyl moieties that are N-acyl substituents of D-alanine.; EC=3.4.16.4; Evidence={ECO:0000255|HAMAP-Rule:MF_01034}; |
DNA Binding | |
EC Number | 3.4.16.4 |
Enzyme Function | |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Transmembrane (1) |
Keywords | Carboxypeptidase;Cell inner membrane;Cell membrane;Hydrolase;Membrane;Protease;Transmembrane;Transmembrane helix |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_01034}; Single-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_01034}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 47,679 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |