| IED ID | IndEnz0002013634 |
| Enzyme Type ID | protease013634 |
| Protein Name |
Kunitz-like toxin PcKuz3 Kunitz-type serine protease inhibitor PcKuz3 PI-sphenopitoxin-Pc1c PI-SPTX-Pc1c |
| Gene Name | |
| Organism | Palythoa caribaeorum (White encrusting zoanthid coral) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Zoantharia (zoanthids) Sphenopidae Palythoa Palythoa caribaeorum (White encrusting zoanthid coral) |
| Enzyme Sequence | CQQPVKPGLCEAYIPRFFYNTSSKQCEKFIYGGCGGNSNRFLTMKACQDKC |
| Enzyme Length | 51 |
| Uniprot Accession Number | P0DQR1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent toxin and weak serine protease inhibitor that displays activity on both trypsin and elastase (PubMed:29285938). May act as a neurotoxin by blocking voltage-gated potassium channels (Kv1.1/KCNA1 and Kv1.2/KCNA2) (Probable). Has a neuroprotective effect, since it suppress, at low concentration, the 6-hydroxydopamine-induced neurotoxicity on the locomotive behavior of zebrafish (PubMed:29285938). In vivo, has strong reversible antilocomotor activity (PubMed:29285938). In addition, it is lethal to zebrafish larvae at high doses (PubMed:29285938). {ECO:0000269|PubMed:29285938, ECO:0000305|PubMed:29285938}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Nematocyst;Neurotoxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,762 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |