| IED ID | IndEnz0002013639 |
| Enzyme Type ID | protease013639 |
| Protein Name |
Kunitz-type U1-aranetoxin-Av1a U1-AATX-Av1a Toxin 1 AvTox-1 |
| Gene Name | |
| Organism | Araneus ventricosus (Orbweaver spider) (Epeira ventricosa) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Araneae (spiders) Araneomorphae Entelegynae Orbiculariae Araneoidea Araneidae (orb weavers) Araneus Araneus ventricosus (Orbweaver spider) (Epeira ventricosa) |
| Enzyme Sequence | MPFHYFPKLNPITWIPGWIPGLGKDRCLLPKVTGPCKASLTRYYYDKDTKACVEFIYGGCRGNRNNFKRKDECEKACTDH |
| Enzyme Length | 80 |
| Uniprot Accession Number | Q8T3S7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Putative insecticidal toxin that may inhibit trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Serine protease inhibitor;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,275 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |