| IED ID | IndEnz0002013648 |
| Enzyme Type ID | protease013648 |
| Protein Name |
Kunitz-type serine protease inhibitor Hg1 Delta-KTx 1.1 |
| Gene Name | |
| Organism | Hoffmannihadrurus gertschi (Scorpion) (Hadrurus gertschi) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Iurida Iuroidea Caraboctonidae Hadrurinae Hadrurus Hoffmannihadrurus gertschi (Scorpion) (Hadrurus gertschi) |
| Enzyme Sequence | MIIFYGLFSILVLTSINIAEAGHHNRVNCLLPPKTGPCKGSFARYYFDIETGSCKAFIYGGCEGNSNNFSEKHHCEKRCRGFRKFGGK |
| Enzyme Length | 88 |
| Uniprot Accession Number | P0C8W3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that completely inhibits the activity of trypsin at a molar ratio of 1:1 (dissociation constant of 107 nM) and that inhibits mKv1.3/KCNA3 potassium channel currents with an IC(50) of 6.2 nM (where 1 uM inhibits 80% of currents). Also has weak inhibitory activity against mKv1.1/KCNA1 (where 1 uM inhibits less than 50% of currents), hKv1.2/KCNA2 (where 1 uM inhibits less than 50% of currents), and hKCa2.3/KCNN3. {ECO:0000269|PubMed:22354971}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Glycosylation (1); Mutagenesis (4); Signal peptide (1); Site (2) |
| Keywords | Disulfide bond;Glycoprotein;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,855 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |