| IED ID | IndEnz0002013660 |
| Enzyme Type ID | protease013660 |
| Protein Name |
Transposon Ty3-G Gag polyprotein Gag3 Transposon Ty3-1 protein A TY3A Cleaved into: Capsid protein CA p24 ; Spacer peptide p3; Nucleocapsid protein p9 NC NCp9 p7 |
| Gene Name | TY3A-G YGRWTy3-1 GAG YGR109W-A G5982 |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPNDASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQLSEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAMEEAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRSYNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARKASSNRS |
| Enzyme Length | 290 |
| Uniprot Accession Number | Q12173 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome.; FUNCTION: Nucleocapsid protein p9 (NC) forms the nucleocore that coats the retro-elements dimeric RNA. Binds these RNAs through its zinc fingers (By similarity). Promotes primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty3 RNA and initiation of reverse transcription. {ECO:0000250, ECO:0000269|PubMed:10593967, ECO:0000269|PubMed:2159534, ECO:0000269|PubMed:7515969, ECO:0000269|PubMed:9707446}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Erroneous initiation (1); Initiator methionine (1); Modified residue (1); Mutagenesis (2); Peptide (1); Site (2); Zinc finger (1) |
| Keywords | Acetylation;Cytoplasm;Metal-binding;Reference proteome;Ribosomal frameshifting;Transposable element;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:1371165}. |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; /evidence=ECO:0000269|PubMed:15956549 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11861848; 17442718; 18094177; 18617996; 19759143; 20444245; 21189452; 21917850; 22998189; 23226439; 24603646; |
| Motif | |
| Gene Encoded By | |
| Mass | 34,027 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |