| IED ID | IndEnz0002013666 |
| Enzyme Type ID | protease013666 |
| Protein Name |
Transposon Ty1-PL Gag polyprotein Gag-p49 Transposon Ty1 protein A TY1A TYA p58 Cleaved into: Capsid protein CA Gag-p45 p54 ; Gag-p4 |
| Gene Name | TY1A-PL YPLWTy1-1 GAG YPL257W-A P0725 |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNYRRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKSTTEPIQLNNKHDLHLRPGTY |
| Enzyme Length | 440 |
| Uniprot Accession Number | P0CX73 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome. The particles are assembled from trimer-clustered units and there are holes in the capsid shells that allow for the diffusion of macromolecules. CA has also nucleocapsid-like chaperone activity, promoting primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty1 RNA and initiation of reverse transcription (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Compositional bias (6); Modified residue (1); Peptide (1); Region (4); Site (1) |
| Keywords | Cytoplasm;Phosphoprotein;RNA-binding;Reference proteome;Ribosomal frameshifting;Transposable element |
| Interact With | |
| Induction | INDUCTION: Ty1-PL is a highly expressed element. Induced under amino acid starvation conditions by GCN4. {ECO:0000269|PubMed:11884596}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | MOD_RES 416; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q12441 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 22998189; 23226439; 24603646; |
| Motif | |
| Gene Encoded By | |
| Mass | 48,953 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |