| IED ID | IndEnz0002013764 |
| Enzyme Type ID | protease013764 |
| Protein Name |
Pre-histone-like nucleoprotein Pre-core protein VII pVII Cleaved into: Histone-like nucleoprotein NP Core protein VII |
| Gene Name | L2 |
| Organism | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus C Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) |
| Enzyme Sequence | MSILISPSNNTGWGLRFPSKMFGGAKKRSDQHPVRVRGHYRAPWGAHKRGRTGRTTVDDAIDAVVEEARNYTPTPPPVSTVDAAIQTVVRGARRYAKMKRRRRRVARRHRRRPGTAAQRAAAALLNRARRTGRRAAMRAARRLAAGIVTVPPRSRRRAAAAAAAAISAMTQGRRGNVYWVRDSVSGLRVPVRTRPPRN |
| Enzyme Length | 198 |
| Uniprot Accession Number | P68951 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plays a role in the inhibition of host immune response within the nucleus. Interacts with cellular nucleosomes and immobilizes the host immune danger signal HMGB1 on chromatin. In turn, prevents HMGB1 release out of the cell and thus decreases inflammation. Plays also a role in the wrapping and condensation of the viral DNA. May also promote viral genome import into the nucleus. {ECO:0000255|HAMAP-Rule:MF_04056}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Erroneous initiation (1); Initiator methionine (1); Modified residue (7); Motif (1); Propeptide (1); Region (1); Site (1) |
| Keywords | 3D-structure;Acetylation;DNA-binding;Host nucleus;Host-virus interaction;Late protein;Phosphoprotein;Viral penetration into host nucleus;Virion;Virus entry into host cell |
| Interact With | P06748 |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000255|HAMAP-Rule:MF_04056}. |
| Subcellular Location | SUBCELLULAR LOCATION: [Histone-like nucleoprotein]: Virion {ECO:0000255|HAMAP-Rule:MF_04056}. Note=Located inside the capsid in association with the viral DNA (core). Present in about 1070 copies per virion. {ECO:0000255|HAMAP-Rule:MF_04056}.; SUBCELLULAR LOCATION: [Pre-histone-like nucleoprotein]: Host nucleus, host nucleolus {ECO:0000255|HAMAP-Rule:MF_04056}. |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056; MOD_RES 27; /note=N6-acetyllysine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056; MOD_RES 48; /note=N6-acetyllysine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056; MOD_RES 55; /note=Phosphothreonine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056; MOD_RES 74; /note=Phosphothreonine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056; MOD_RES 183; /note=Phosphoserine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056; MOD_RES 185; /note=Phosphoserine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04056 |
| Post Translational Modification | PTM: Cleaved near the N-terminus by the viral protease during virion maturation to form the mature protein. {ECO:0000255|HAMAP-Rule:MF_04056}. |
| Signal Peptide | |
| Structure 3D | Electron microscopy (1) |
| Cross Reference PDB | 6B1T; |
| Mapped Pubmed ID | 17602943; 28978703; |
| Motif | MOTIF 188..198; /note=Nuclear localization signal; /evidence=ECO:0000255|HAMAP-Rule:MF_04056 |
| Gene Encoded By | |
| Mass | 21,992 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |