| IED ID | IndEnz0002013790 |
| Enzyme Type ID | protease013790 |
| Protein Name |
Ras-related protein Rab-7L1 Rab-7-like protein 1 Ras-related protein Rab-29 |
| Gene Name | RAB29 RAB7L1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC |
| Enzyme Length | 203 |
| Uniprot Accession Number | O14966 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The small GTPases Rab are key regulators in vesicle trafficking (PubMed:24788816). Essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (PubMed:24788816). Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity (PubMed:29212815). Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection (PubMed:22042847). {ECO:0000250|UniProtKB:Q63481, ECO:0000269|PubMed:22042847, ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 14..21; /note=GTP; /evidence=ECO:0000250; NP_BIND 33..39; /note=GTP; /evidence=ECO:0000250; NP_BIND 63..67; /note=GTP; /evidence=ECO:0000250; NP_BIND 125..128; /note=GTP; /evidence=ECO:0000250; NP_BIND 156..157; /note=GTP; /evidence=ECO:0000250 |
| Features | Alternative sequence (2); Beta strand (7); Chain (1); Helix (7); Lipidation (2); Modified residue (2); Motif (1); Mutagenesis (6); Nucleotide binding (5); Site (1); Turn (2) |
| Keywords | 3D-structure;Alternative splicing;Cell membrane;Cytoplasm;Cytoskeleton;Differentiation;GTP-binding;Golgi apparatus;Lipoprotein;Membrane;Nucleotide-binding;Phosphoprotein;Prenylation;Protein transport;Reference proteome;Transport;Vacuole |
| Interact With | O95751; Q5S007; Q04864-2; P14373; Q13049 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Lipid-anchor {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Cytoplasm {ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:24788816}. Golgi apparatus {ECO:0000269|PubMed:22042847}. Golgi apparatus, trans-Golgi network {ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}. Vacuole {ECO:0000269|PubMed:22042847}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:22042847}. Note=Colocalizes with LRRK2 along tubular structures emerging from Golgi apparatus (PubMed:29212815). Colocalizes with GM130 at the Golgi apparatus (PubMed:22042847). Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus (PubMed:22042847). Colocalizes with TGN46 at the trans-Golgi network (TGN) (PubMed:24788816). In Salmonella enterica serovar Typhi (S.Typhi) infected epithelial cells, is recruited and colocalized with both S.Typhi-containing vacuoles and dynamic tubules as well as those emerging from the vacuole toward the cell periphery (PubMed:22042847). {ECO:0000269|PubMed:22042847, ECO:0000269|PubMed:24788816, ECO:0000269|PubMed:29212815}. |
| Modified Residue | MOD_RES 71; /note=Phosphothreonine; by LRRK2; /evidence=ECO:0000269|PubMed:29212815; MOD_RES 72; /note=Phosphoserine; by LRRK2; /evidence=ECO:0000269|PubMed:29212815 |
| Post Translational Modification | PTM: In case of Salmonella enterica serovar Typhimurium (S.Typhimurium) infection, is proteolytically cleaved between Gly-41 and Val-42 by the GtgE viral protease encoded on the Gifsy-2 lysogen bacteriophage, which therefore prevents the recruitment of RAB29 to S.Typhimurium-containing vacuoles. In contrast, no proteolytically cleavage is detected in S.Typhi-infected cells (PubMed:22042847). {ECO:0000269|PubMed:22042847}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6HH2; |
| Mapped Pubmed ID | 11141079; 11389151; 11675392; 15231747; 1648736; 17114793; 17411337; 18532927; 19603039; 19915576; 20683486; 20711500; 21812739; 22232350; 23395371; 23820587; 24023390; 24510904; 25040112; 25341920; 26021297; 26344175; 26914237; 28245721; 28334866; 28807727; 29177506; 29223392; 30037848; 31552791; 31624137; 31818509; 32709066; 7957092; 7991565; 8164745; 8349690; 8375503; 8513495; 8631982; 8662963; 8836150; |
| Motif | MOTIF 36..44; /note=Effector region; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 23,155 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |