| IED ID | IndEnz0002013812 |
| Enzyme Type ID | protease013812 |
| Protein Name |
Transcriptional regulatory protein RcsA Colanic acid capsular biosynthesis activation protein A |
| Gene Name | rcsA b1951 JW1935 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIHDASNSQRIKLIINQHPNTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDILKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR |
| Enzyme Length | 207 |
| Uniprot Accession Number | P0DMC9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 155..174; /note=H-T-H motif; /evidence=ECO:0000255|HAMAP-Rule:MF_00982 |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the Rcs signaling system, which controls transcription of numerous genes. Binds, with RcsB, to the RcsAB box to regulate expression of genes involved in colanic acid capsule synthesis. {ECO:0000255|HAMAP-Rule:MF_00982, ECO:0000269|PubMed:10702265, ECO:0000269|PubMed:1999391}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (1); Mutagenesis (1) |
| Keywords | Activator;Capsule biogenesis/degradation;DNA-binding;Direct protein sequencing;Reference proteome;Sensory transduction;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Autoregulated. Repressed by H-NS. Induced by the DsrA small regulatory RNA, which inhibits the H-NS mediated transcriptional silencing. {ECO:0000269|PubMed:10702265, ECO:0000269|PubMed:7534408}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Degraded by the Lon and the HslUV proteases (PubMed:1999391 and PubMed:14766922). Interaction with RcsB protects RcsA from degradation (PubMed:1999391). {ECO:0000269|PubMed:1999391}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15690043; 16606699; 20952573; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,516 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |