| IED ID | IndEnz0002013814 |
| Enzyme Type ID | protease013814 |
| Protein Name |
Rhomboid protein 2 EC 3.4.21.- |
| Gene Name | rbd2 AFUA_6G12750 |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Enzyme Sequence | MAIPAALPPLPFNPTRVRSYMLRLPLFTRLVLLVILAFWLLELQTIWSVVQWGSLTPNEIGIGSMYRLNTYPFIHVGFFHAFVNLLALTPLLERFEAEHGTLTAVALFIGPLSTFPAGIYILVEKFILRSNTAVVGASVWIFLLLGSEAIKTFKSNPYFSLGTTKIPTWTSPLFACALVSIFVPNTSFLGHLSAIIIGYLLGLGYLKVFVPPEKILRWIEGKLNLLGRLPHYVSVDQKTYGRYGVLPTATAAVGGERPTPLSYLGTNQRLGP |
| Enzyme Length | 272 |
| Uniprot Accession Number | Q4WLP9 |
| Absorption | |
| Active Site | ACT_SITE 138; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 191; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Probable serine protease. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Transmembrane (6) |
| Keywords | Golgi apparatus;Hydrolase;Membrane;Protease;Reference proteome;Serine protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus, cis-Golgi network membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,091 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |