| IED ID | IndEnz0002013828 |
| Enzyme Type ID | protease013828 |
| Protein Name |
Cysteine protease RD19A EC 3.4.22.- Protein RESPONSIVE TO DEHYDRATION 19 RD19 |
| Gene Name | RD19A At4g39090 F19H22.190 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MDRLKLYFSVFVLSFFIVSVSSSDVNDGDDLVIRQVVGGAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKDGKTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTAH |
| Enzyme Length | 368 |
| Uniprot Accession Number | P43296 |
| Absorption | |
| Active Site | ACT_SITE 159; /evidence=ECO:0000255|PROSITE-ProRule:PRU10088; ACT_SITE 302; /evidence=ECO:0000255|PROSITE-ProRule:PRU10089; ACT_SITE 329; /evidence=ECO:0000255|PROSITE-ProRule:PRU10090 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Probable thiol protease (By similarity). Required for RRS1-mediated resistance against Ralstonia solanacearum. Plays a crucial role as host factor for PopP2-triggered RRS1-mediated resistance. Interacts with the R.solanacearum type III effector PopP2 to form a nuclear complex that is required for activation of the RRS1-mediated resistance response (PubMed:18708476). {ECO:0000250|UniProtKB:P43297, ECO:0000269|PubMed:18708476}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Glycosylation (1); Propeptide (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Nucleus;Protease;Reference proteome;Signal;Thiol protease;Vacuole;Zymogen |
| Interact With | |
| Induction | INDUCTION: By high salt conditions (PubMed:8325504). Induced by drought stress (PubMed:8325504, PubMed:12102506). {ECO:0000269|PubMed:12102506, ECO:0000269|PubMed:8325504}. |
| Subcellular Location | SUBCELLULAR LOCATION: Lytic vacuole {ECO:0000269|PubMed:18708476}. Nucleus {ECO:0000269|PubMed:18708476}. Note=Predominantly vacuolar. From the Golgi apparatus, probably transported to the lytic vacuole (LV) in clathrin-coated vesicles (CCVs) via the prevacuolar compartment (PVC). Relocalizes to the nucleus when associated in a complex with the Ralstonia solanacearum type III effector PopP2. {ECO:0000269|PubMed:18708476}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11779861; 12169696; 12509532; 12598574; 12947053; 14535883; 14617064; 14697270; 16307366; 16581873; 16630346; 16920880; 18650403; 18775970; 18805951; 18808718; 31858133; |
| Motif | |
| Gene Encoded By | |
| Mass | 40,419 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |