| IED ID |
IndEnz0002013833 |
| Enzyme Type ID |
protease013833 |
| Protein Name |
Cytochrome b-c1 complex subunit 2, mitochondrial
|
| Gene Name |
QCR2 CNAG_05179 |
| Organism |
Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) (Filobasidiella neoformans var. grubii) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Fungi
Dikarya
Basidiomycota
Agaricomycotina
Tremellomycetes
Tremellales (jelly fungi)
Cryptococcaceae
Cryptococcus
Cryptococcus neoformans species complex
Cryptococcus neoformans (Filobasidiella neoformans)
Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)
Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) (Filobasidiella neoformans var. grubii)
|
| Enzyme Sequence |
MYSLNRLPRSAAFKSSANLLRRNASTTSAGGVNVVGFENKGPAATSSLTVAIKAGSRYETTPGVAHVLKSFAYKATASASALRTAREAELYGGVLSAALTREHLLLSAEFLRGDEEHFLNVLASVLSSSQFYRHELSELVLPVVEAETISSQAIPSTIALDLAHSLAFRRGLGNSLYANKNYPVSIDDVKSFGEAAFAKSNIAVIGTGVSTEALAKAVSNAFGAGTSSGSKLSTPKANYYGGETRVPLDIHAPATATPTMVIAFGTSSPASADLKVLKHLLGGETSVKWTPGASPLAQAADKIPGASAKAFLLPYSDAALFGVVLSAPTSAETKTLAQEVASIVKNAGEFKEEEVKRAVAKATFEDAASTETLSGFVAAAGPAALVGSVPEAQSFSGVSASSISKAAGELLKGKPTVVSIGNISVLPYADELGL |
| Enzyme Length |
434 |
| Uniprot Accession Number |
J9VPD8 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c. {ECO:0000250|UniProtKB:P07257}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Transit peptide (1) |
| Keywords |
Electron transport;Membrane;Mitochondrion;Mitochondrion inner membrane;Respiratory chain;Transit peptide;Transport |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250|UniProtKB:P07257}; Peripheral membrane protein {ECO:0000250|UniProtKB:P07257}; Matrix side {ECO:0000250|UniProtKB:P07257}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
44,542 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|