| IED ID | IndEnz0002013843 |
| Enzyme Type ID | protease013843 |
| Protein Name |
Cytochrome b-c1 complex subunit 2, mitochondrial Complex III subunit 2 Core protein II Ubiquinol-cytochrome-c reductase complex core protein 2 |
| Gene Name | Uqcrc2 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MKLLSRAGSFSRFYSLKVAPKLKTSAPGGVPLQPQELEFTKLPNGLVIASLENYAPLSRIGLFIKAGSRYENYNYLGTSHLLRLASTLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRDDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNPQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSILKEVAEQFLNIRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSQQPFDVSAFNASYSDSGLFGIYTVSQAAAAGDVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALATGSYMPPPTVLQQIDAVADADVVKAAKKFVSGKKSMTASGNLGHTPFLDEL |
| Enzyme Length | 452 |
| Uniprot Accession Number | P32551 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c (By similarity). The 2 core subunits UQCRC1/QCR1 and UQCRC2/QCR2 are homologous to the 2 mitochondrial-processing peptidase (MPP) subunits beta-MPP and alpha-MPP respectively, and they seem to have preserved their MPP processing properties. May be involved in the in situ processing of UQCRFS1 into the mature Rieske protein and its mitochondrial targeting sequence (MTS)/subunit 9 when incorporated into complex III (By similarity). {ECO:0000250|UniProtKB:P07257, ECO:0000250|UniProtKB:P23004}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (4); Sequence conflict (1); Transit peptide (1) |
| Keywords | Acetylation;Direct protein sequencing;Electron transport;Membrane;Mitochondrion;Mitochondrion inner membrane;Phosphoprotein;Reference proteome;Respiratory chain;Transit peptide;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250|UniProtKB:P07257}; Peripheral membrane protein {ECO:0000250|UniProtKB:P07257}; Matrix side {ECO:0000250|UniProtKB:P07257}. |
| Modified Residue | MOD_RES 65; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9DB77; MOD_RES 198; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9DB77; MOD_RES 249; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9DB77; MOD_RES 367; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:22673903 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12794875; 16396496; 16518874; 19166612; 19562802; 19935650; 22960082; |
| Motif | |
| Gene Encoded By | |
| Mass | 48,396 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |