Detail Information for IndEnz0002013853
IED ID IndEnz0002013853
Enzyme Type ID protease013853
Protein Name Methyltransferase pytC
EC 2.1.1.-
Pyranterreones biosynthesis cluster protein C
Gene Name pytC ATEG_00912 ATETN484_0003083300
Organism Aspergillus terreus
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus terreus
Enzyme Sequence MTVRTAAEPPNRIEVDMDAPSLDTDSSCTSLSSSVQRYEYKHGRRYHGYHAGSYPFPNDKREQDRLDMIHHLYTRILNDRLFLAPLDPRGKAILDIGTGTGIWALHMGDAHPAARLIVGNDLSPIQPSWAPANVRFVVDDVEKDWVDRHPYDFIHCRYMAGSIKDWPRLIRQCYAHLRPGGWLELQESVNVMYSEDGTLPPDSFMARMMHGLIVACEKIGRTMDPAPSMEKWVQEAGFDPITKHRFKIPVGSWPKDPRLKECGSLMRVNFVEGVEAFTASLFTEVLGWTPEEVAVLNTGVREEAMRNDIHAIFDFVVIVAQKPY
Enzyme Length 324
Uniprot Accession Number P9WEZ3
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 2.1.1.-
Enzyme Function FUNCTION: Methyltransferase; part of the gene cluster that mediates the biosynthesis of pyranterreones, a family of antioxidative compounds (PubMed:32077283). The first step of pyranonigrins biosynthesis is performed by the hybrid PKS-NRPS synthetase pytA that condenses 4 malonyl-CoA units ato the acetyl starter unit by the modular PKS of pytA (PubMed:32077283). The acyl chain is then connected to an L-serine through the amide bond by the modular NRPS of pytA (PubMed:32077283). A tetramic acid is formed and released from the PKS-NRPS pytA to give pyranterreone 5 with the help of the thioesterase pytI (PubMed:32077283). Pyranterreone 5 could be methylated by pytC to afford pyranterreone 6 (Probable). Both pyranterreones 5 and 6 are subsequently oxidized by the FAD-linked oxidoreductase pytB and the cytochrome P450 monooxygenase pytD to form the fused gamma-pyrone core, resulting in pyranterreones 7 and 11, respectively (PubMed:32077283). The hydroxy group at C-8 of pyranterreones 7 and 11 are dehydrated by the aspartyl protease pytH to form a delta-7 double bond to give pyranterreones 3 and 1, 2 accordingly (PubMed:32077283). The exo-methylene of pyranterreone 3 could be reduced into a pendant methyl by reductase pytE to provide pyranterreone 4, also known as cordylactam (Probable). Pyranterreone 4 can be reconverted to pyranterreone 3 through pytB-catalyzed dehydrogenation or further oxidized to pyranterreones 9 and 10 (Probable). {ECO:0000269|PubMed:32077283, ECO:0000305|PubMed:32077283}.
Temperature Dependency
PH Dependency
Pathway PATHWAY: Secondary metabolite biosynthesis. {ECO:0000269|PubMed:32077283}.
nucleotide Binding
Features Chain (1); Region (1)
Keywords Methyltransferase;S-adenosyl-L-methionine;Transferase
Interact With
Induction INDUCTION: Expression is positively regulated by the cluster-specific transcription factor pytR. {ECO:0000269|PubMed:32077283}.
Subcellular Location
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 36,850
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda