Detail Information for IndEnz0002013893
IED ID IndEnz0002013893
Enzyme Type ID protease013893
Protein Name DNA repair protein RadA
EC 3.6.4.-
Branch migration protein RadA
Gene Name radA BH0104
Organism Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Alkalihalobacillus Alkalihalobacillus halodurans (Bacillus halodurans) Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)
Enzyme Sequence MAKKKTKFMCQECGYESAKWMGKCPGCQSWNSMVEEFTEVKAKSSRSYVTSGAGIAKPQPITKVEREQEPRIDTSMKELNRVLGGGIVPGSLVLVGGDPGIGKSTLLLQLSARLADLKQRVLYISGEESVKQTKIRSDRLGVLSDHLYVLAETDMEKIEQAIGEVDPTLVIIDSIQTVYQDEITSAPGSVAQVRECTASFMRIAKTTGVAIFIVGHVTKQGAIAGPKLLEHMVDSVLYFEGERHHTYRILRAVKNRFGSTNEMGIFEMKESGLEEVANPSEIFLEDRSSGVAGSTVVASMEGTRPVLVELQALISPTSFGNPRRMATGVDHNRISLLMAVLEKRVGMLLQNQDAYVNVAGGVRLDEPAIDLGIAVSIASSFRNQHTNPHEVVIGEIGLTGEVRRVSRIDQRVNEAAKLGFKRVIIPDKNLGGWTIPSTIEVIGVSTVQDALEVTLGR
Enzyme Length 457
Uniprot Accession Number Q9KGG1
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.6.4.-
Enzyme Function FUNCTION: DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function. {ECO:0000255|HAMAP-Rule:MF_01498}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding NP_BIND 97..104; /note=ATP; /evidence=ECO:0000255|HAMAP-Rule:MF_01498
Features Chain (1); Motif (1); Nucleotide binding (1); Region (1); Zinc finger (1)
Keywords ATP-binding;DNA damage;DNA repair;DNA-binding;Hydrolase;Metal-binding;Nucleotide-binding;Reference proteome;Stress response;Zinc;Zinc-finger
Interact With
Induction
Subcellular Location
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 254..258; /note=RadA KNRFG motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01498
Gene Encoded By
Mass 49,763
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda