IED ID | IndEnz0002013896 |
Enzyme Type ID | protease013896 |
Protein Name |
DNA repair protein RadA EC 3.6.4.- Branch migration protein RadA DNA repair protein Sms |
Gene Name | radA orf5 sms yacJ BSU00870 |
Organism | Bacillus subtilis (strain 168) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
Enzyme Sequence | MAKTKSKFICQSCGYESPKWMGKCPGCGAWNTMVEEMIKKAPANRRAAFSHSVQTVQKPSPITSIETSEEPRVKTQLGEFNRVLGGGVVKGSLVLIGGDPGIGKSTLLLQVSAQLSGSSNSVLYISGEESVKQTKLRADRLGINNPSLHVLSETDMEYISSAIQEMNPSFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMKIAKTKGIPIFIVGHVTKEGSIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPSEIFLEERSAGSAGSSITASMEGTRPILVEIQALISPTSFGNPRRMATGIDHNRVSLLMAVLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAIVISIASSFRDTPPNPADCFIGEVGLTGEVRRVSRIEQRVKEAAKLGFKRMIIPAANLDGWTKPKGIEVIGVANVAEALRTSLGG |
Enzyme Length | 458 |
Uniprot Accession Number | P37572 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.6.4.- |
Enzyme Function | FUNCTION: DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function. {ECO:0000255|HAMAP-Rule:MF_01498}.; FUNCTION: Plays a role in DNA repair (PubMed:9141693, PubMed:11810266). Might stabilize or process Holliday junction intermediates (PubMed:15317759). May work with DisA following methyl methanesulfonate (MMS) but not H(2)O(2) damage; DisA is a DNA integrity scanning protein with c-di-AMP synthase activity. {ECO:0000269|PubMed:15317759, ECO:0000269|PubMed:9141693}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | NP_BIND 98..105; /note=ATP; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
Features | Chain (1); Motif (1); Nucleotide binding (1); Region (1); Zinc finger (1) |
Keywords | ATP-binding;DNA damage;DNA repair;DNA-binding;Hydrolase;Metal-binding;Nucleotide-binding;Reference proteome;Stress response;Zinc;Zinc-finger |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 255..259; /note=RadA KNRFG motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
Gene Encoded By | |
Mass | 49,483 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda | 3.6.4.B7; |