| IED ID | IndEnz0002013902 |
| Enzyme Type ID | protease013902 |
| Protein Name |
DNA repair protein RadA EC 3.6.4.- Branch migration protein RadA |
| Gene Name | radA DR_1105 |
| Organism | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Deinococcus-Thermus Deinococci Deinococcales Deinococcaceae Deinococcus Deinococcus radiodurans Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) |
| Enzyme Sequence | MERVAVLFRRTCNSENCSKGRRPLRERPLAGLFFCSLPAPLSIPCLSLPGSNPGDFVPKVKTNYICNSCGYQSAKPLGRCPNCQAWNSFEEEVPTASTSGKSGRGGLGGYGGVKGGKLTPLSTVGRREEPRTPSGIPELDRVLGGGLVAGGVTLIGGEPGIGKSTLLLQVADKVASRGGTVLYVAGEESLEQIRLRADRLGVAADLQMTRDTRAEHIAALLEEHKPALCIVDSIQTVTVEGEGAPGGVAQVRDGTAMLTRAAKETGTATVLVGHVTKDGTVAGPKVMEHIVDTTVFLETVGAFRLLRSVKNRFGQAGELGVFEMRGEGLIAVDNPSAAFLAERPLDVPGSVVAATVDGQRPMLLEVQALASKTPYPNARRVVVGLDPRRVDVVLAVLERRLDLTLGGLDVYVNLAGGLKVPDPGLDLAVALAVYSAVVGRALPQNVAVFGEVGLAGEVRSTQMALRRAEEAGRAGYKRLVVPPGLDGQAGVKSVEEAVKAVWR |
| Enzyme Length | 503 |
| Uniprot Accession Number | Q9RVC4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.6.4.- |
| Enzyme Function | FUNCTION: DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function. {ECO:0000255|HAMAP-Rule:MF_01498}.; FUNCTION: Plays a role in DNA damage repair (Ref.2). Following severe irradiation (IR, 7 kGy of gamma irradiation), genomic DNA is fragmented and progressively degraded for the first 1.5 hours after IR, in a step promoted by RecA and counterbalanced by DNA Pol I and Pol III. This is followed by massive DNA synthesis and genome reassembly in the next hour. Optimal priming of DNA synthesis requires both RecA and RadA. Pol III initiates DNA synthesis while both Pol I and Pol III are required for its continuation (PubMed:19303848). {ECO:0000269|PubMed:19303848, ECO:0000269|Ref.2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 157..164; /note=ATP; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
| Features | Chain (1); Motif (1); Nucleotide binding (1); Region (2); Zinc finger (1) |
| Keywords | ATP-binding;DNA damage;DNA repair;DNA-binding;Hydrolase;Metal-binding;Nucleotide-binding;Reference proteome;Stress response;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 310..314; /note=RadA KNRFG motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
| Gene Encoded By | |
| Mass | 52,758 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |