IED ID | IndEnz0002013910 |
Enzyme Type ID | protease013910 |
Protein Name |
DNA repair protein RadA EC 3.6.4.- Branch migration protein RadA |
Gene Name | radA sarII sms lmo0233 |
Organism | Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) |
Enzyme Sequence | MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKSRSAFNHTGEPSKATPITQIASETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKSTLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETIDFVKPDFVVIDSIQTVYHSDVTSAAGSVSQVRECTATLMRIAKMQNIAIFIVGHVTKEGAIAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSEVFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAVLEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLTGEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGNWKIPKDVQVVGVETIGEALKKALPD |
Enzyme Length | 457 |
Uniprot Accession Number | Q48761 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.6.4.- |
Enzyme Function | FUNCTION: DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function. {ECO:0000255|HAMAP-Rule:MF_01498}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | NP_BIND 97..104; /note=ATP; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
Features | Chain (1); Motif (1); Nucleotide binding (1); Region (1); Sequence conflict (19); Zinc finger (1) |
Keywords | ATP-binding;DNA damage;DNA repair;DNA-binding;Hydrolase;Metal-binding;Nucleotide-binding;Reference proteome;Stress response;Zinc;Zinc-finger |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 254..258; /note=RadA KNRFG motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
Gene Encoded By | |
Mass | 49,982 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |