| IED ID | IndEnz0002013913 |
| Enzyme Type ID | protease013913 |
| Protein Name |
DNA repair protein RadA EC 3.6.4.- Branch migration protein RadA |
| Gene Name | radA MSMEG_6079 MSMEI_5919 |
| Organism | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycolicibacterium Mycolicibacterium smegmatis (Mycobacterium smegmatis) Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Enzyme Sequence | MAGSKIRSQYRCSECQHVAPKWVGRCANCGTWGTVDEVAVLAGNNKLNGAARRSVAPTSPAVPITSIDPGVTRHYPTGVSELDRVLGGGLVAGSVTLLAGDPGVGKSTLLLEVANRWAHSGKRALYLSGEESAGQIRLRAERTGCTHDQVYLAAESDLQIALGHIDEVKPSLVVVDSVQTMSTTEADGVTGGVTQVRAVTTSLTAYAKAAVGDPAVAMILVGHVTKDGAIAGPRSLEHLVDVVLHFEGDRASSLRMVRGVKNRFGAADEVGCFQLHDNGIECVSDPSGLFLDQRPLAVPGTAVTVTLDGKRPMIGEVQALVSPPAGPPRRAVSGIDSARAAMIGAVLQTRCRMPINSNDLYLSTVGGMRLTDPSADLAVALAIASAYFDIAMPMKAIAIGEVGLAGDLRRVTGMDRRLSEAARLGFTTAVVPPGVTSAPAGLKVVAADNIRAAVQTMREIAIAGAQ |
| Enzyme Length | 466 |
| Uniprot Accession Number | A0R563 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.6.4.- |
| Enzyme Function | FUNCTION: DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function (By similarity). Also inhibits the diadenylate cyclase activity of DisA (PubMed:23760274). {ECO:0000255|HAMAP-Rule:MF_01498, ECO:0000269|PubMed:23760274}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 100..107; /note=ATP; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
| Features | Chain (1); Motif (1); Nucleotide binding (1); Region (1); Zinc finger (1) |
| Keywords | ATP-binding;DNA damage;DNA repair;DNA-binding;Hydrolase;Metal-binding;Nucleotide-binding;Reference proteome;Stress response;Zinc;Zinc-finger |
| Interact With | |
| Induction | INDUCTION: Forms part of an operon with disA. {ECO:0000269|PubMed:23760274}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 261..265; /note=RadA KNRFG motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
| Gene Encoded By | |
| Mass | 48,332 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |