| IED ID | IndEnz0002013917 |
| Enzyme Type ID | protease013917 |
| Protein Name |
DNA repair protein RadA EC 3.6.4.- Branch migration protein RadA |
| Gene Name | radA PA4609 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa group Pseudomonas aeruginosa Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Enzyme Sequence | MAKAKRMYGCTECGATFPKWAGQCADCGAWNTLVETVVEAAPSGSGRGGWAGQQANLKTLAEVSVEEMPRFTTGSTELDRVLGGGLVDGSVVLIGGDPGIGKSTILLQTLCNLASRVPALYVTGEESQQQVAMRARRLSLPEDKLKVMTETSIETIIATARQEQPRVMVIDSIQTIFTEQLQSAPGGVAQVRESAAMLVRYAKQSGTAIFLVGHVTKEGALAGPRVLEHMVDTVLYFEGESDGRLRLLRAVKNRFGAVNELGVFGMTDKGLKEVSNPSAIFLTRAQEAVPGSVVMATWEGSRPMLVEVQALVDTSHLANPRRVTLGLDQNRLAMLLAVLHRHGGIPTYDQDVFLNVVGGVKVLETASDLALMAAVMSSLRNRPLPHDLLVFGEVGLSGEVRPVPSGQERLKEAGKHGFKRAIVPLGNAPKEAPAGLQVIAVTRLEQALDALFE |
| Enzyme Length | 453 |
| Uniprot Accession Number | P96963 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.6.4.- |
| Enzyme Function | FUNCTION: DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function. {ECO:0000255|HAMAP-Rule:MF_01498}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 96..103; /note=ATP; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
| Features | Chain (1); Motif (1); Nucleotide binding (1); Region (1); Sequence conflict (5); Zinc finger (1) |
| Keywords | ATP-binding;DNA damage;DNA repair;DNA-binding;Hydrolase;Metal-binding;Nucleotide-binding;Reference proteome;Stress response;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 252..256; /note=RadA KNRFG motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01498 |
| Gene Encoded By | |
| Mass | 48,411 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |