| IED ID | IndEnz0002013933 |
| Enzyme Type ID | protease013933 |
| Protein Name |
Renin EC 3.4.23.15 Angiotensinogenase |
| Gene Name | REN |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR |
| Enzyme Length | 406 |
| Uniprot Accession Number | P00797 |
| Absorption | |
| Active Site | ACT_SITE 104; ACT_SITE 292 |
| Activity Regulation | ACTIVITY REGULATION: Interaction with ATP6AP2 results in a 5-fold increased efficiency in angiotensinogen processing. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of Leu-|-Xaa bond in angiotensinogen to generate angiotensin I.; EC=3.4.23.15; |
| DNA Binding | |
| EC Number | 3.4.23.15 |
| Enzyme Function | FUNCTION: Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Alternative sequence (1); Beta strand (29); Chain (1); Disulfide bond (3); Domain (1); Glycosylation (2); Helix (14); Natural variant (6); Propeptide (1); Sequence conflict (4); Signal peptide (1); Turn (5) |
| Keywords | 3D-structure;Alternative splicing;Aspartyl protease;Cleavage on pair of basic residues;Direct protein sequencing;Disease variant;Disulfide bond;Glycoprotein;Hydrolase;Membrane;Protease;Reference proteome;Secreted;Signal;Zymogen |
| Interact With | P01019 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Membrane. Note=Associated to membranes via binding to ATP6AP2. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:2016271 |
| Structure 3D | X-ray crystallography (88) |
| Cross Reference PDB | 1BBS; 1BIL; 1BIM; 1HRN; 1RNE; 2BKS; 2BKT; 2FS4; 2G1N; 2G1O; 2G1R; 2G1S; 2G1Y; 2G20; 2G21; 2G22; 2G24; 2G26; 2G27; 2I4Q; 2IKO; 2IKU; 2IL2; 2REN; 2V0Z; 2V10; 2V11; 2V12; 2V13; 2V16; 2X0B; 3D91; 3G6Z; 3G70; 3G72; 3GW5; 3K1W; 3KM4; 3O9L; 3OAD; 3OAG; 3OOT; 3OQF; 3OQK; 3OWN; 3Q3T; 3Q4B; 3Q5H; 3SFC; 3VCM; 3VSW; 3VSX; 3VUC; 3VYD; 3VYE; 3VYF; 4AMT; 4GJ5; 4GJ6; 4GJ7; 4GJ8; 4GJ9; 4GJA; 4GJB; 4GJC; 4GJD; 4PYV; 4Q1N; 4RYC; 4RYG; 4RZ1; 4S1G; 4XX3; 4XX4; 5KOQ; 5KOS; 5KOT; 5SXN; 5SY2; 5SY3; 5SZ9; 5T4S; 5TMG; 5TMK; 5V8V; 5VPM; 5VRP; 6I3F; |
| Mapped Pubmed ID | 10665661; 10903938; 11224002; 11409653; 11776100; 11800056; 11803527; 11903315; 12186695; 12394950; 12431442; 12431445; 12473863; 12544508; 12556231; 12569263; 12613527; 12684512; 12695419; 12736712; 12854169; 12862204; 12927775; 12933794; 14530292; 15075192; 15368359; 15662219; 15739123; 15837327; 15914769; 16036389; 16138564; 16169070; 16189286; 16375820; 16396763; 16446393; 16480874; 16615274; 16672053; 16790508; 16933186; 16940215; 16990260; 17113558; 17158202; 17416596; 17455195; 17476284; 17485830; 17546276; 17562974; 17574423; 17660193; 17693975; 17703434; 17785633; 1807356; 18077515; 18091737; 18175911; 18188989; 18192836; 18202178; 18205094; 18212269; 18259612; 18260994; 18325076; 18483152; 18486430; 18508487; 18519826; 18632798; 18698213; 18718746; 18722896; 18794727; 18856058; 18922597; 18953568; 19023100; 19073901; 19126660; 19144755; 19243623; 19358611; 19369955; 19457666; 19473121; 19509012; 19513539; 19536175; 19673942; 19716087; 19733264; 19759335; 19761684; 19853442; 19891555; 19913121; 19959358; 20160196; 20201926; 20223792; 20379614; 20380117; 20429690; 20452482; 20486282; 20502328; 20529973; 20537141; 20577119; 20628086; 20662730; 20673868; 20702505; 20826507; 20843686; 20850300; 20861226; 20884641; 20925572; 21036942; 21084044; 21111986; 21112780; 21163863; 21330419; 21330422; 21340620; 21424086; 21443456; 21490026; 21521263; 21576655; 21659414; 21697610; 21712789; 21741239; 21742440; 21840218; 21881521; 21941204; 21941205; 22022827; 22042811; 22136493; 22193701; 22396488; 22453004; 22459392; 22575890; 22676457; 22695510; 22721990; 22726934; 23077077; 23108193; 23111329; 23122821; 23292178; 23358739; 23360239; 23425156; 23461768; 24154707; 24164175; 24218434; 24284398; 24436325; 24900262; 24900544; 24965793; 25050166; 25143328; 25237165; 25279703; 25333683; 25491485; 25510769; 25534858; 25660845; 25728416; 25754490; 25767135; 25782742; 25849646; 26076559; 26102248; 26163660; 26300226; 26366736; 26489635; 26753721; 27271344; 27428770; 27534428; 27687967; 27720325; 27774132; 27927648; 28019132; 28276504; 28395289; 28455747; 28640140; 28641212; 28747358; 28875746; 2892488; 28985999; 29123029; 29233044; 29548814; 29960014; 30563843; 31177424; 31409916; 31473089; 31622820; 32682174; 32750457; 33043632; 33184370; 33508746; 33677630; 33750025; 33878417; 34021479; 34310595; 34576290; 4289389; 4322712; 4330891; 4360430; 7493993; 7608971; 7902711; 7915644; 9172787; 9237498; |
| Motif | |
| Gene Encoded By | |
| Mass | 45,057 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1 uM for angiotensinogen (in absence of ATP6AP2); KM=0.15 uM for angiotensinogen (in presence of membrane-bound ATP6AP2); |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.15; |