Detail Information for IndEnz0002013958
IED ID IndEnz0002013958
Enzyme Type ID protease013958
Protein Name Bone morphogenetic protein 4
BMP-4
Bone morphogenetic protein 2B
BMP-2B
Gene Name Bmp4 Bmp-4 Dvr-4
Organism Rattus norvegicus (Rat)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat)
Enzyme Sequence MIPGNRMLMVVLLCQVLLGGATDASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLENIPGTSESSAFRFFFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEMVPGHLITRLLDTRLVRHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Enzyme Length 408
Uniprot Accession Number Q06826
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis (By similarity). Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity). Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase, PI3K/Akt, or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response (By similarity). {ECO:0000250|UniProtKB:P12644, ECO:0000250|UniProtKB:P21275}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Compositional bias (1); Disulfide bond (4); Glycosylation (4); Modified residue (1); Propeptide (1); Region (2); Signal peptide (1)
Keywords Chondrogenesis;Cleavage on pair of basic residues;Cytokine;Developmental protein;Differentiation;Disulfide bond;Extracellular matrix;Glycoprotein;Growth factor;Osteogenesis;Phosphoprotein;Reference proteome;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix.
Modified Residue MOD_RES 91; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P12644
Post Translational Modification
Signal Peptide SIGNAL 1..19; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10404008; 10701160; 12395077; 12475223; 12514223; 12552124; 12730624; 12801979; 12808102; 14643011; 15352071; 15589212; 15991191; 16245174; 16388796; 16416307; 16420416; 16447265; 16551644; 16651391; 16730912; 16818050; 16828469; 17069773; 17112416; 17161201; 17272757; 17286956; 17537984; 17570215; 17661743; 17696121; 18280291; 18758911; 19229878; 19287192; 19723531; 20660069; 20844246; 20877159; 21142982; 22027561; 22710965; 23236544; 23325243; 23770801; 7911662; 8385738; 8769111; 9246083;
Motif
Gene Encoded By
Mass 46,541
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda