| IED ID | IndEnz0002013980 |
| Enzyme Type ID | protease013980 |
| Protein Name |
Angiotensin-converting enzyme ACE EC 3.2.1.- EC 3.4.15.1 Dipeptidyl carboxypeptidase I Kininase II CD antigen CD143 Fragment |
| Gene Name | ACE DCP1 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFAASFNSSAEQVLFQSTAASWAHDTNITEENARLQEEAALLSQEFSEAWGQK |
| Enzyme Length | 100 |
| Uniprot Accession Number | P12820 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of a C-terminal dipeptide, oligopeptide-|-Xaa-Yaa, when Xaa is not Pro, and Yaa is neither Asp nor Glu. Thus, conversion of angiotensin I to angiotensin II, with increase in vasoconstrictor activity, but no action on angiotensin II.; EC=3.4.15.1; |
| DNA Binding | |
| EC Number | 3.2.1.-; 3.4.15.1 |
| Enzyme Function | FUNCTION: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1); Region (1); Signal peptide (1); Topological domain (1) |
| Keywords | Carboxypeptidase;Direct protein sequencing;Hydrolase;Metalloprotease;Protease;Reference proteome;Secreted;Signal;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence="ECO:0000269|PubMed:2835538, ECO:0000269|PubMed:3028395" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 17928627; |
| Motif | |
| Gene Encoded By | |
| Mass | 10,681 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.15.1; |