| IED ID | IndEnz0002013992 |
| Enzyme Type ID | protease013992 |
| Protein Name |
Acrosin EC 3.4.21.10 Cleaved into: Acrosin light chain; Acrosin heavy chain Fragment |
| Gene Name | ACR |
| Organism | Capra hircus (Goat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Capra Capra hircus (Goat) |
| Enzyme Sequence | RDNTTCDGPCGIRFRQNRXXXXRIIGGQDAAHGSWPWMVSLQIFTYHNNRRYHVCGGSLL |
| Enzyme Length | 60 |
| Uniprot Accession Number | P10626 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by SERPINA5. {ECO:0000250}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.; EC=3.4.21.10; |
| DNA Binding | |
| EC Number | 3.4.21.10 |
| Enzyme Function | FUNCTION: Acrosin is the major protease of mammalian spermatozoa. It is a serine protease of trypsin-like cleavage specificity, it is synthesized in a zymogen form, proacrosin and stored in the acrosome. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (2); Domain (1); Glycosylation (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,879 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |