| IED ID | IndEnz0002014003 |
| Enzyme Type ID | protease014003 |
| Protein Name |
Venom serine protease inhibitor AcVSPI VSPI Allergen Api m 6-like peptide |
| Gene Name | |
| Organism | Apis cerana (Indian honeybee) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Aculeata Apoidea (bees) Apidae (bumble bees and honey bees) Apinae (honey bees) Apini Apis Apis cerana (Indian honeybee) |
| Enzyme Sequence | MPRLVLVSFLFLAIFSVFIGGFAKSKCPRNEIFTRCHAACQPSCARLARKPFCIKICKPGCICTSGYLRNKNNVCVPRSRCFSGRLL |
| Enzyme Length | 87 |
| Uniprot Accession Number | A0A2R4SV19 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Antifibrinolytic and antimicrobial serine protease inhibitor. Inhibits trypsin, plasmin and microbial serine proteases but not chymotrypsin, thrombin and elastase. Inhibits the plasmin-mediated degradation of fibrin to fibrin degradation products. Also binds to bacterial and fungal surfaces and exhibits antimicrobial activity against fungi as well as Gram-positive and Gram-negative bacteria. {ECO:0000269|PubMed:28917645}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Antibiotic;Antimicrobial;Disulfide bond;Fungicide;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:28917645}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,733 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |