| IED ID | IndEnz0002014191 |
| Enzyme Type ID | protease014191 |
| Protein Name |
Aminopeptidase G EC 3.4.11.- Fragment |
| Gene Name | pepG |
| Organism | Streptomyces lividans |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces lividans |
| Enzyme Sequence | LQMLHAWTNSALVHYAAPDWRETGGRLLGEGALRELRDGRRAASSSWPGRGSSRRWRPGRRTGAAARGCWRAP |
| Enzyme Length | 73 |
| Uniprot Accession Number | Q54340 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.11.- |
| Enzyme Function | FUNCTION: Hydrolyzes preferentially the N-terminal glycine and can also hydrolyze other amino acids which are used by PepN but is unable to hydrolyze basic amino acids. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (2); Region (1) |
| Keywords | Aminopeptidase;Cytoplasm;Hydrolase;Metalloprotease;Protease;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,125 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |