| IED ID | IndEnz0002014195 |
| Enzyme Type ID | protease014195 |
| Protein Name |
CD9 antigen CD antigen CD9 |
| Gene Name | Cd9 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV |
| Enzyme Length | 226 |
| Uniprot Accession Number | P40240 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion (PubMed:10700183, PubMed:10634790, PubMed:10634791, PubMed:14715942). Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (PubMed:10700183, PubMed:10634790, PubMed:10634791, PubMed:21690351). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (PubMed:23575678). In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (PubMed:12796480). Acts as a receptor for PSG17 (PubMed:11805154). Involved in platelet activation and aggregation (PubMed:14715942). Regulates paranodal junction formation (PubMed:14715942). Involved in cell adhesion, cell motility and tumor metastasis (By similarity). Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung (PubMed:18662991). {ECO:0000250|UniProtKB:P21926, ECO:0000269|PubMed:10634790, ECO:0000269|PubMed:10634791, ECO:0000269|PubMed:10700183, ECO:0000269|PubMed:11805154, ECO:0000269|PubMed:12796480, ECO:0000269|PubMed:14715942, ECO:0000269|PubMed:18662991, ECO:0000269|PubMed:21690351, ECO:0000269|PubMed:23575678}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Lipidation (6); Mutagenesis (2); Topological domain (5); Transmembrane (4) |
| Keywords | Cell adhesion;Cell membrane;Disulfide bond;Fertilization;Glycoprotein;Lipoprotein;Membrane;Palmitate;Reference proteome;Secreted;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10518536, ECO:0000269|PubMed:10634791, ECO:0000269|PubMed:11805154, ECO:0000269|PubMed:23213457}; Multi-pass membrane protein {ECO:0000269|PubMed:11805154}. Membrane {ECO:0000269|PubMed:11805154}; Multi-pass membrane protein {ECO:0000269|PubMed:11805154}. Secreted, extracellular exosome {ECO:0000269|PubMed:26109643}. Note=Present at the cell surface of oocytes (PubMed:10518536, PubMed:10634791, PubMed:23213457). Accumulates in the adhesion area between the sperm and egg following interaction between IZUMO1 and its receptor IZUMO1R/JUNO (PubMed:25209248). {ECO:0000269|PubMed:10518536, ECO:0000269|PubMed:10634791, ECO:0000269|PubMed:23213457, ECO:0000269|PubMed:25209248}. |
| Modified Residue | |
| Post Translational Modification | PTM: Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro). The protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids. Palmitoylation by ZDHHC2 regulates CD9 expression, association with other tetraspanin family proteins and function in cell adhesion. {ECO:0000250|UniProtKB:P21926}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10512203; 10948653; 11217851; 11504738; 11906941; 11950938; 12056820; 12083484; 12086470; 12135680; 12420314; 12466851; 12483205; 12745436; 12904583; 14530327; 14610273; 14723852; 15199151; 15284116; 15772125; 15840001; 15902693; 16054021; 16116178; 16144798; 16380109; 16418227; 16595723; 16602821; 16719947; 16753027; 16808899; 16900214; 17043104; 17060475; 17126340; 17190803; 17239847; 17307168; 17582603; 17684062; 17882221; 17967808; 18559949; 18728192; 18754795; 18799693; 19010935; 19107828; 19210920; 19363789; 19414791; 19414803; 19521500; 19716222; 19777564; 20347150; 20428892; 20592186; 21267068; 21858196; 21881583; 22084105; 22216174; 22554680; 22609062; 22687584; 22819339; 22946049; 23223239; 23226274; 23341629; 23395392; 23443658; 23575960; 23824580; 23863478; 24040034; 24154525; 24205035; 24736431; 24934154; 24952961; 25503725; 25564652; 25706271; 27784871; 27879451; 28361920; 28533221; 28576770; 28759649; 29370390; 29572511; 29671763; 30328350; 30517011; 30718289; 31341160; 31682865; 31685994; 32150249; 32231207; 32346137; 32665248; 33227706; 33724343; 7590978; 7650394; 8838570; 9373040; 9436464; 9660840; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,258 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |