| IED ID | IndEnz0002014240 |
| Enzyme Type ID | protease014240 |
| Protein Name |
NIP3 homolog CeBNIP3 Daf-16/FOXO controlled germline tumor affecting-1 |
| Gene Name | dct-1 C14F5.1 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MSSFLEFAKPKMLDIKRKINFASGEKTDESVQPQQQTEQSSAQQTTPSAKAVSNPFITPLTESTPGMSESWVELAPSRTSLCSSVDINMVIIDEKDKDSRLSPVSIAQSPHVEFESLEQVKYKLVREMLPPGKNTDWIWDWSSRPENTPPKTVRMVQYGSNLTTPPNSPEPELYQYLPCESDSLFNVRVVFGFLVTNIFSFVVGAAVGFAVCRKLIKHHRQ |
| Enzyme Length | 221 |
| Uniprot Accession Number | Q09969 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Initiates apoptosis in a BH3-independent mechanism possibly by recruiting ced-3 to mitochondria and other cytoplasmic membranes (PubMed:11114722). Has a role in lifespan and tumor growth (PubMed:16380712, PubMed:17934462). Required for the induction of mitophagy under stress conditions (PubMed:25896323). {ECO:0000269|PubMed:11114722, ECO:0000269|PubMed:16380712, ECO:0000269|PubMed:17934462, ECO:0000269|PubMed:25896323}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Compositional bias (1); Cross-link (1); Region (2); Transmembrane (1) |
| Keywords | Alternative splicing;Apoptosis;Autophagy;Isopeptide bond;Membrane;Mitochondrion;Mitochondrion outer membrane;Reference proteome;Transmembrane;Transmembrane helix;Ubl conjugation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion outer membrane {ECO:0000269|PubMed:25896323}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Ubiquitinated and degraded by the proteasome (PubMed:11114722). Under oxidative stress conditions, ubiquitinated at Lys-26 in a pink-1 dependent manner. Colocalizes with pdr-1 and may be ubiquitinated by it (PubMed:25896323). {ECO:0000269|PubMed:11114722, ECO:0000269|PubMed:25896323}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11381264; 21177967; 22286215; 22560298; 23800452; 25487147; 27400265; 29211722; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,843 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |